HPA017672

ACKR1 antibody from Sigma-Aldrich
CCBP1, CD234, DARC, Dfy, FY, GPD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017672
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017672, RRID:AB_1849221
Product name
Anti-DARC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017672
Antibody type
Polyclonal
Antigen
Duffy antigen/chemokine receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSF
PDGDYGANLEAAAPCHSCNLLDDS
Storage
-20C
Provider Type Product Number
- No reagents -