HPA017672

ACKR1 antibody from Atlas Antibodies
CCBP1, CD234, DARC, Dfy, FY, GPD

Antibody data

Product number
HPA017672
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017672, RRID:AB_1849221
Product name
Anti-ACKR1
Provider product page
Atlas Antibodies - HPA017672
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSF
PDGDYGANLEAAAPCHSCNLLDDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.