HPA052324

G6PC antibody from Atlas Antibodies
G6PC1, G6PT, GSD1a
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA052324
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052324, RRID:AB_2681790
Product name
Anti-G6PC
Provider product page
Atlas Antibodies - HPA052324
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -