HPA029056

ZNF354B antibody from MilliporeSigma / Merck KGaA
FLJ25008, KID2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029056
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029056, RRID:AB_10603006
Product name
Anti-ZNF354B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029056
Antibody type
Polyclonal
Antigen
zinc finger protein 354B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CKSTPKMTKSTQTQDSFQEQIRKRLKRDEPWNFIS
ERSCIYEEKLKKQQDKNENLQIISVAHTKILTVDR
SHKNVEFGQNFYLKSVFIKQ
Storage
-20C
Provider Type Product Number
- No reagents -