HPA034998

LRRC29 antibody from MilliporeSigma / Merck KGaA
FBL9, FBXL9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034998
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034998, RRID:AB_10601938
Product name
Anti-LRRC29 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034998
Antibody type
Polyclonal
Antigen
leucine rich repeat containing 29 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDV
ATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLT
LTL
Storage
-20C
Provider Type Product Number
- No reagents -