HPA000734

GUCY2F antibody from Sigma-Aldrich
CYGF, GC-F, GUC2DL, RetGC-2, ROS-GC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000734
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000734, RRID:AB_10599299
Product name
Anti-GUCY2F antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000734
Antibody type
Polyclonal
Antigen
guanylate cyclase 2F, retinal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVS
PLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQH
SRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEW
ELHSTYTVDMEMELLR
Storage
-20C
Provider Type Product Number
- No reagents -