HPA024761

ZNF502 antibody from Sigma-Aldrich
FLJ12515, FLJ14855
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024761
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024761, RRID:AB_10599830
Product name
Anti-ZNF502 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024761
Antibody type
Polyclonal
Antigen
zinc finger protein 502 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLNMQGAEERDIRRETCPGWVNKNKPALEQDVCKI
DSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPR
EIAES
Storage
-20C
Provider Type Product Number
- No reagents -