Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311461 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Cytochrome P450, Family 1, Subfamily B, Polypeptide 1 (CYP1B1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CYP1B1 antibody: synthetic peptide directed towards the middle region of human CYP1B1
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRT
VGAGS LVDVMPWLQY- Vial size
- 50 µg
Submitted references TGF-β1 signaling plays a dominant role in the crosstalk between TGF-β1 and the aryl hydrocarbon receptor ligand in prostate epithelial cells.
Aryl hydrocarbon receptor-mediated up-regulation of ATP-driven xenobiotic efflux transporters at the blood-brain barrier.
Staršíchová A, Hrubá E, Slabáková E, Pernicová Z, Procházková J, Pěnčíková K, Seda V, Kabátková M, Vondráček J, Kozubík A, Machala M, Souček K
Cellular signalling 2012 Aug;24(8):1665-76
Cellular signalling 2012 Aug;24(8):1665-76
Aryl hydrocarbon receptor-mediated up-regulation of ATP-driven xenobiotic efflux transporters at the blood-brain barrier.
Wang X, Hawkins BT, Miller DS
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Feb;25(2):644-52
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Feb;25(2):644-52
No comments: Submit comment
No validations: Submit validation data