Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011047-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011047-M01, RRID:AB_534771
- Product name
- ADRM1 monoclonal antibody (M01), clone 3C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ADRM1.
- Antigen sequence
ASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQT
DDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQ
CPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCR
KVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQ
SLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLA
SLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTRA
TPAPSAPAAASATSPSPAPSSGNGASTAASPTQPI
QLSDLQSILATMNVPAGPAGGQQVDLASVLAPEIM
APILANADVQERLLPYLPSGESLPQTADEIQNTLT
SPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVE
AANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEE
DMSLD- Isotype
- IgG
- Antibody clone number
- 3C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Biological and molecular heterogeneity of breast cancers correlates with their cancer stem cell content.
Phospho-ΔNp63α/Rpn13-dependent regulation of LKB1 degradation modulates autophagy in cancer cells.
Phosphorylated TP63 induces transcription of RPN13, leading to NOS2 protein degradation.
Pece S, Tosoni D, Confalonieri S, Mazzarol G, Vecchi M, Ronzoni S, Bernard L, Viale G, Pelicci PG, Di Fiore PP
Cell 2010 Jan 8;140(1):62-73
Cell 2010 Jan 8;140(1):62-73
Phospho-ΔNp63α/Rpn13-dependent regulation of LKB1 degradation modulates autophagy in cancer cells.
Huang Y, Ratovitski EA
Aging 2010 Dec;2(12):959-68
Aging 2010 Dec;2(12):959-68
Phosphorylated TP63 induces transcription of RPN13, leading to NOS2 protein degradation.
Huang Y, Ratovitski EA
The Journal of biological chemistry 2010 Dec 31;285(53):41422-31
The Journal of biological chemistry 2010 Dec 31;285(53):41422-31
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ADRM1 monoclonal antibody (M01), clone 3C6 Western Blot analysis of ADRM1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ADRM1 expression in transfected 293T cell line by ADRM1 monoclonal antibody (M01), clone 3C6.Lane 1: ADRM1 transfected lysate(42.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ADRM1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ADRM1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of ADRM1 transfected lysate using anti-ADRM1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ADRM1 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol