HPA017983

MAS1L antibody from Sigma-Aldrich
dJ994E9.2, MAS-L, MRG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017983
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017983, RRID:AB_1849332
Product name
Anti-MAS1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017983
Antibody type
Polyclonal
Antigen
Mas-related G-protein coupled receptor MRG recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQN
PNLVSQLCGVFLQNETNETIHMQMSMAVGQQALPL
NIIA
Storage
-20C
Provider Type Product Number
- No reagents -