Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003430-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003430-M01, RRID:AB_530086
- Product name
- IFI35 monoclonal antibody (M01), clone 3H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IFI35.
- Antigen sequence
GVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQK
AEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQ
KPTRGGGEVEALTVVPQGQQGLAVFTSESG- Isotype
- IgG
- Antibody clone number
- 3H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of alpha interferon-induced genes associated with antiviral activity in Daudi cells and characterization of IFIT3 as a novel antiviral gene.
Schmeisser H, Mejido J, Balinsky CA, Morrow AN, Clark CR, Zhao T, Zoon KC
Journal of virology 2010 Oct;84(20):10671-80
Journal of virology 2010 Oct;84(20):10671-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IFI35 monoclonal antibody (M01), clone 3H6 Western Blot analysis of IFI35 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IFI35 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol