Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184171 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ring-Box 1, E3 Ubiquitin Protein Ligase (RBX1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RBX1 antibody: synthetic peptide directed towards the middle region of human RBX1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQV
CPLDN REWEFQKYGH- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
Zheng N, Schulman BA, Song L, Miller JJ, Jeffrey PD, Wang P, Chu C, Koepp DM, Elledge SJ, Pagano M, Conaway RC, Conaway JW, Harper JW, Pavletich NP
Nature 2002 Apr 18;416(6882):703-9
Nature 2002 Apr 18;416(6882):703-9
No comments: Submit comment
No validations: Submit validation data