HPA014096

GRM5 antibody from Sigma-Aldrich
GPRC1E, mGlu5, MGLUR5, PPP1R86
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014096
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014096, RRID:AB_1853918
Product name
Anti-GRM5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014096
Antibody type
Polyclonal
Antigen
Metabotropic glutamate receptor 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKPSDGRKLLESLMKTNFTGVSGDTILFDENGDSP
GRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDE
VWSKKSNIIRSVCSEPCEKGQIKVIRKG
Storage
-20C
Provider Type Product Number
- No reagents -