Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004736-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004736-M01, RRID:AB_509171
- Product name
- RPL10A monoclonal antibody (M01), clone 3G2
- Antibody type
- Monoclonal
- Antigen
- RPL10A (NP_009035, 108 a.a. ~ 217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Antigen sequence
DAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNE
NMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDD
ELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGK
PQRLY- Isotype
- IgG
- Vial size
- 100 µg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RPL10A monoclonal antibody (M01), clone 3G2. Western Blot analysis of RPL10A expression in Raw 264.7 ( Cat # L024V1 ).
- Validation comment
- Western Blot (Cell lysate)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RPL10A is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RPL10A on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RPL10A on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol