HPA064835

antibody from Atlas Antibodies

Targeting: GALM

Antibody data

Submit

Validation data

Product number: HPA064835 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA064835, RRID:AB_2732723
Product name: Anti-GALM
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTF KVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVL SNGVQFSRISPDGEEG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GALM protein structure - HPA064835 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and skin tissues using Anti-GALM antibody. Corresponding GALM RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, cerebral cortex, kidney and skin using Anti-GALM antibody HPA064835 (A) shows similar protein distribution across tissues to independent antibody HPA035472 (B).
Antibody #2 product nr: HPA035472, HPA035473
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-GALM antibody HPA064835.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland using Anti-GALM antibody HPA064835.
Sample type: HUMAN