H00006432-B02P

SRSF7 antibody from Abnova Corporation
9G8, AAG3, HSSG1, RBM37, SFRS7, ZCCHC20, ZCRB2

Antibody data

Product number
H00006432-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006432-B02P, RRID:AB_1580556
Product name
SFRS7 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00006432-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SFRS7 protein.
Antigen sequence
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYG
PLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGK
VICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDR
CYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRG
RRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSAS
LRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSR
SKSRSPSPKRSRSPSGSPRRSASPERMD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -