HPA017674

P2RY1 antibody from Sigma-Aldrich
P2Y1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017674
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017674, RRID:AB_1854881
Product name
Anti-P2RY1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017674
Antibody type
Polyclonal
Antigen
P2Y purinoceptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAA
VSSSFKCALTKTGFQFYY
Storage
-20C
Provider Type Product Number
- No reagents -