HPA030118

ARHGAP33 antibody from MilliporeSigma / Merck KGaA
FLJ39019, SNX26, TCGAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030118
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030118, RRID:AB_10601238
Product name
Anti-SNX26 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030118
Antibody type
Polyclonal
Antigen
sorting nexin 26 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSECVELFTERPGPGLKADADGPPCGIPAPQGISS
LTSAVPRPRGKLAGLLRTFMRSRPSRQRLRQRGIL
Storage
-20C
Provider Type Product Number
- No reagents -