HPA013573

ADGRL2 antibody from MilliporeSigma / Merck KGaA
KIAA0786, LEC1, LPHH1, LPHN2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013573
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013573, RRID:AB_1853241
Product name
Anti-LPHN2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013573
Antibody type
Polyclonal
Antigen
Latrophilin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITS
SAELFKTIISTTSTTSQKGPMSTTVAGSQEGSKGT
KPPPAVSTTKIPPITNIFPLPERFCEALDSKGIKW
PQTQRGMMVERPCPKGT
Storage
-20C
Provider Type Product Number
- No reagents -