SAB2100960

GPR18 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
SAB2100960
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100960, RRID:AB_10603270
Product name
Anti-GPR18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100960
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_005283.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDI
IYLKAVNVLNLTRLT
Storage
-20C
Provider Type Product Number
- No reagents -