Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- A1059-62J - Provider product page

- Provider
- United States Biological
- Product name
- AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide corresponding to aa 82-131, SPRRCVRLHESCLG QQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT a region within the carboxy domain of mouse agouti related protein.
- Description
- Serum
- Host
- Guinea Pig
- Isotype
- IgG
- Vial size
- Blue Ice
- Concentration
- ~1mg/ml
- Storage
- 4°C (-20°C Glycerol)
No comments: Submit comment
No validations: Submit validation data