HPA013169

XCR1 antibody from Sigma-Aldrich
CCXCR1, GPR5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013169
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013169, RRID:AB_1846211
Product name
Anti-XCR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013169
Antibody type
Polyclonal
Antigen
Chemokine XC receptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MESSGNPESTTFFYYDLQSQPCENQAWVFATLA
Storage
-20C
Provider Type Product Number
- No reagents -