Antibody data

Product number
HPA060379
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA060379, RRID:AB_2684269
Product name
Anti-ARL4D
Provider product page
Atlas Antibodies - HPA060379
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.