H00001299-M02A

COL9A3 antibody from Abnova Corporation
DJ885L7.4.1, EDM3, FLJ90759, IDD, MED
No application information provided.

Antibody data

Product number
H00001299-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001299-M02A, RRID:AB_1204163
Product name
COL9A3 monoclonal antibody (M02A), clone 2B5
Provider product page
Abnova Corporation - H00001299-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant COL9A3.
Antigen sequence
GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGL
DGQKGEAGRNGAPGEKGPNGLPGL
Isotype
IgM
Antibody clone number
2B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -