Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00255426-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00255426-M01, RRID:AB_509211
- Product name
- RASGEF1C monoclonal antibody (M01), clone 3H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RASGEF1C.
- Antigen sequence
QGPEGLVGADKPISYRTKPPASIHRELLGVCSDPY
TLAQQLTHVELERLRHIGPEEFVQAFVNKDPLAST
KPCFSDKTSNLEAYVKWFNRLCY- Isotype
- IgG
- Antibody clone number
- 3H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RASGEF1C expression in transfected 293T cell line by RASGEF1C monoclonal antibody (M01), clone 3H8.Lane 1: RASGEF1C transfected lysate(56.907 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RASGEF1C on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RASGEF1C on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol