Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022949-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022949-A01, RRID:AB_463656
- Product name
- LTB4DH polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LTB4DH.
- Antigen sequence
MKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQE
LRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYK
EYIIEGFENMPAAFMGMLKGDNLGKTIVK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Up-regulation of human prostaglandin reductase 1 improves the efficacy of hydroxymethylacylfulvene, an antitumor chemotherapeutic agent.
Yu X, Erzinger MM, Pietsch KE, Cervoni-Curet FN, Whang J, Niederhuber J, Sturla SJ
The Journal of pharmacology and experimental therapeutics 2012 Nov;343(2):426-33
The Journal of pharmacology and experimental therapeutics 2012 Nov;343(2):426-33
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LTB4DH polyclonal antibody (A01), Lot # 051212JC01 Western Blot analysis of LTB4DH expression in 293 ( Cat # L026V1 ).