Antibody data

Product number
H00001845-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001845-M01A, RRID:AB_1204288
Product name
DUSP3 monoclonal antibody (M01A), clone 5B7
Provider product page
Abnova Corporation - H00001845-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant DUSP3.
Antigen sequence
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTP
RIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMH
VNTNANFYKDSGITYLGIKANDTQEFNLSAYFERA
ADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLM
MRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLND
RLAKEGKLKP
Isotype
IgG
Antibody clone number
5B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -