Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184237 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Serotonin Receptor 1A (HTR1A) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HTR1A antibody: synthetic peptide directed towards the N terminal of human HTR1A
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSL
LLGTL IFCAVLGNAC- Vial size
- 50 µg
Submitted references 17β-estradiol-induced regulation of the novel 5-HT1A-related transcription factors NUDR and Freud-1 in SH SY5Y cells.
Decreased expression of Freud-1/CC2D1A, a transcriptional repressor of the 5-HT1A receptor, in the prefrontal cortex of subjects with major depression.
Differential regulation of the serotonin 1 A transcriptional modulators five prime repressor element under dual repression-1 and nuclear-deformed epidermal autoregulatory factor by chronic stress.
Characterization of serotonin receptors in pregnant human myometrium.
Gender-specific decrease in NUDR and 5-HT1A receptor proteins in the prefrontal cortex of subjects with major depressive disorder.
Cell-specific repressor or enhancer activities of Deaf-1 at a serotonin 1A receptor gene polymorphism.
Adeosun SO, Albert PR, Austin MC, Iyo AH
Cellular and molecular neurobiology 2012 May;32(4):517-21
Cellular and molecular neurobiology 2012 May;32(4):517-21
Decreased expression of Freud-1/CC2D1A, a transcriptional repressor of the 5-HT1A receptor, in the prefrontal cortex of subjects with major depression.
Szewczyk B, Albert PR, Rogaeva A, Fitzgibbon H, May WL, Rajkowska G, Miguel-Hidalgo JJ, Stockmeier CA, Woolverton WL, Kyle PB, Wang Z, Austin MC
The international journal of neuropsychopharmacology / official scientific journal of the Collegium Internationale Neuropsychopharmacologicum (CINP) 2010 Sep;13(8):1089-101
The international journal of neuropsychopharmacology / official scientific journal of the Collegium Internationale Neuropsychopharmacologicum (CINP) 2010 Sep;13(8):1089-101
Differential regulation of the serotonin 1 A transcriptional modulators five prime repressor element under dual repression-1 and nuclear-deformed epidermal autoregulatory factor by chronic stress.
Iyo AH, Kieran N, Chandran A, Albert PR, Wicks I, Bissette G, Austin MC
Neuroscience 2009 Nov 10;163(4):1119-27
Neuroscience 2009 Nov 10;163(4):1119-27
Characterization of serotonin receptors in pregnant human myometrium.
Cordeaux Y, Pasupathy D, Bacon J, Charnock-Jones DS, Smith GC
The Journal of pharmacology and experimental therapeutics 2009 Mar;328(3):682-91
The Journal of pharmacology and experimental therapeutics 2009 Mar;328(3):682-91
Gender-specific decrease in NUDR and 5-HT1A receptor proteins in the prefrontal cortex of subjects with major depressive disorder.
Szewczyk B, Albert PR, Burns AM, Czesak M, Overholser JC, Jurjus GJ, Meltzer HY, Konick LC, Dieter L, Herbst N, May W, Rajkowska G, Stockmeier CA, Austin MC
The international journal of neuropsychopharmacology / official scientific journal of the Collegium Internationale Neuropsychopharmacologicum (CINP) 2009 Mar;12(2):155-68
The international journal of neuropsychopharmacology / official scientific journal of the Collegium Internationale Neuropsychopharmacologicum (CINP) 2009 Mar;12(2):155-68
Cell-specific repressor or enhancer activities of Deaf-1 at a serotonin 1A receptor gene polymorphism.
Czesak M, Lemonde S, Peterson EA, Rogaeva A, Albert PR
The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 Feb 8;26(6):1864-71
The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 Feb 8;26(6):1864-71
No comments: Submit comment
No validations: Submit validation data