HPA018073

HTR1A antibody from Sigma-Aldrich
5-HT1A, ADRB2RL1, ADRBRL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018073
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018073, RRID:AB_1856704
Product name
Anti-HTR1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018073
Antibody type
Polyclonal
Antigen
5-hydroxytryptamine receptor 1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGV
ESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSK
EHLPLPSEAGPTPCAPASFERKNERNAEAKRKMAL
A
Storage
-20C
Provider Type Product Number
- No reagents -