HPA018073

HTR1A antibody from Atlas Antibodies
5-HT1A, ADRB2RL1, ADRBRL1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018073
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018073, RRID:AB_1856704
Product name
Anti-HTR1A
Provider product page
Atlas Antibodies - HPA018073
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGV
ESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSK
EHLPLPSEAGPTPCAPASFERKNERNAEAKRKMAL
A
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -