HPA026438

MRTO4 antibody from Sigma-Aldrich
C1orf33, dJ657E11.4, MRT4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026438
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026438, RRID:AB_10598908
Product name
Anti-MRTO4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026438
Antibody type
Polyclonal
Antigen
mRNA turnover 4 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFI
FSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVAL
GRSPSD
Storage
-20C
Provider Type Product Number
- No reagents -