H00003598-B01

IL13RA2 antibody from Abnova Corporation
CD213a2, CT19, IL-13R, IL13BP

Antibody data

Product number
H00003598-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003598-B01, RRID:AB_1018202
Product name
IL13RA2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00003598-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human IL13RA2 protein.
Antigen sequence
MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPP
QDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYE
LKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKI
HTLLPWQCTNGSEVQSSWAETTYWISPQGIPETKV
QDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWY
EGLDHALQCVDYIKADGQNIGCRFPYLEASDYKDF
YICVNGSSENKPIRSSYFTFQLQNIVKPLPPVYLT
FTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDD
TTLVTATVENETYTLKTTNETRQLCFVVRSKVNIY
CSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGF
ILILVIFVTGLLLRKPNTYPKMIPEFFCDT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -