Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003598-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003598-M01, RRID:AB_534902
- Product name
- IL13RA2 monoclonal antibody (M01), clone 2E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IL13RA2.
- Antigen sequence
DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDH
FKECTVEYELKYRNIGSETWKTIITKNLHYKDGFD
LNKGIEAKIHTLLPWQCTNGSEVQSSWAET- Isotype
- IgG
- Antibody clone number
- 2E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Normal-appearing white matter in multiple sclerosis is in a subtle balance between inflammation and neuroprotection.
Zeis T, Graumann U, Reynolds R, Schaeren-Wiemers N
Brain : a journal of neurology 2008 Jan;131(Pt 1):288-303
Brain : a journal of neurology 2008 Jan;131(Pt 1):288-303
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- IL13RA2 monoclonal antibody (M01), clone 2E10. Western Blot analysis of IL13RA2 expression in HeLa.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of IL13RA2 expression in transfected 293T cell line by IL13RA2 monoclonal antibody (M01), clone 2E10.Lane 1: IL13RA2 transfected lysate(44.176 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged IL13RA2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol