HPA026568

CFAP97D1 antibody from Sigma-Aldrich
C17orf105
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026568
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026568, RRID:AB_10601689
Product name
Anti-C17orf105 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026568
Antibody type
Polyclonal
Antigen
LOC284067 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IANAHRGPAKVDCWNEYFSKSLNRETRNRELVRIT
MENQGILKRLVDRKPHYDRRASEIDWQNSRRYIRN
TTRYLLSQ
Storage
-20C
Provider Type Product Number
- No reagents -