Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014259 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-PTGDR2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RDTISRLDGRIMCYYNVLLLNPGPDRDATCNSRQA
ALAVSKF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references The development of a GPR44 targeting radioligand [11C]AZ12204657 for in vivo assessment of beta cell mass
Novel pancreatic beta cell-specific proteins: Antibody-based proteomics for identification of new biomarker candidates
Jahan M, Johnström P, Selvaraju R, Svedberg M, Winzell M, Bernström J, Kingston L, Schou M, Jia Z, Skrtic S, Johansson L, Korsgren O, Farde L, Halldin C, Eriksson O
EJNMMI Research 2018;8(1)
EJNMMI Research 2018;8(1)
Novel pancreatic beta cell-specific proteins: Antibody-based proteomics for identification of new biomarker candidates
Lindskog C, Korsgren O, Pontén F, Eriksson J, Johansson L, Danielsson A
Journal of Proteomics 2012;75(9):2611-2620
Journal of Proteomics 2012;75(9):2611-2620
No comments: Submit comment
No validations: Submit validation data