Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054585-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054585-M01, RRID:AB_565920
- Product name
- LZTFL1 monoclonal antibody (M01), clone 7F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LZTFL1.
- Antigen sequence
KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQK
SLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTA
AYRNMKEILTKKNDQIKDLRKRLAQYEPED- Isotype
- IgG
- Antibody clone number
- 7F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened.
Seo S, Zhang Q, Bugge K, Breslow DK, Searby CC, Nachury MV, Sheffield VC
PLoS genetics 2011 Nov;7(11):e1002358
PLoS genetics 2011 Nov;7(11):e1002358
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LZTFL1 monoclonal antibody (M01), clone 7F6 Western Blot analysis of LZTFL1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody (M01), clone 7F6.Lane 1: LZTFL1 transfected lysate(34.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LZTFL1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to LZTFL1 on HeLa cell. [antibody concentration 25 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to LZTFL1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol