Antibody data

Product number
H00054585-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054585-M09, RRID:AB_1576953
Product name
LZTFL1 monoclonal antibody (M09), clone 1B1
Provider product page
Abnova Corporation - H00054585-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant LZTFL1.
Antigen sequence
LKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESEL
INTAYTNVLLLRQLFAQAEKWYLKLQTDISELENQ
ELLEQVAEFEKA
Isotype
IgG
Antibody clone number
1B1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -