HPA013955

GPR19 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013955
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013955, RRID:AB_1849287
Product name
Anti-GPR19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013955
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYL
MELSEEHSWMSNQTD
Storage
-20C
Provider Type Product Number
- No reagents -