HPA030380

MAP4K3 antibody from MilliporeSigma / Merck KGaA
GLK, MAPKKKK3, RAB8IPL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030380
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030380, RRID:AB_10601132
Product name
Anti-MAP4K3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030380
Antibody type
Polyclonal
Antigen
mitogen-activated protein kinase kinase kinase kinase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRL
PPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGT
NLSRKEKKDVP
Storage
-20C
Provider Type Product Number
- No reagents -