H00004673-M01
antibody from Abnova Corporation
Targeting: NAP1L1
MGC23410, MGC8688, NAP1, NAP1L, NRP
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004673-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004673-M01, RRID:AB_1679028
- Product name
- NAP1L1 monoclonal antibody (M01), clone 2A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NAP1L1.
- Antigen sequence
MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKA
RQLTVQMMQNPQILAALQERLDGLVETPTGYIESL
PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERK
YAVLY- Isotype
- IgG
- Antibody clone number
- 2A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NAP1L1 monoclonal antibody (M01), clone 2A9. Western Blot analysis of NAP1L1 expression in HeLa(Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NAP1L1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol