Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035526 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA035526, RRID:AB_10672867
- Product name
- Anti-FYCO1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKY
LEERLIELLRDKDALWQKSDALEFQQKLSAEERWL
GDTEANHCLDCKREFS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The autophagic protein FYCO1 controls TNFRSF10/TRAIL receptor induced apoptosis and is inactivated by CASP8 (caspase 8)
SMG6 localizes to the chromatoid body and shapes the male germ cell transcriptome to drive spermatogenesis
Compromised mitochondrial quality control triggers lipin1-related rhabdomyolysis
FYCO1 and autophagy control the integrity of the haploid male germ cell-specific RNP granules
Repeated ER–endosome contacts promote endosome translocation and neurite outgrowth
FYCO1 Contains a C-terminally Extended, LC3A/B-preferring LC3-interacting Region (LIR) Motif Required for Efficient Maturation of Autophagosomes during Basal Autophagy
Coppola V, Marino I, Warnken U, Falchi M, Pasquini L, Biffoni M, De Maria R, Haas T
Autophagy 2023;19(10):2733-2751
Autophagy 2023;19(10):2733-2751
SMG6 localizes to the chromatoid body and shapes the male germ cell transcriptome to drive spermatogenesis
Lehtiniemi T, Bourgery M, Ma L, Ahmedani A, Mäkelä M, Asteljoki J, Olotu O, Laasanen S, Zhang F, Tan K, Chousal J, Burow D, Koskinen S, Laiho A, Elo L, Chalmel F, Wilkinson M, Kotaja N
Nucleic Acids Research 2022;50(20):11470-11491
Nucleic Acids Research 2022;50(20):11470-11491
Compromised mitochondrial quality control triggers lipin1-related rhabdomyolysis
Hamel Y, Mauvais F, Madrange M, Renard P, Lebreton C, Nemazanyy I, Pellé O, Goudin N, Tang X, Rodero M, Tuchmann-Durand C, Nusbaum P, Brindley D, van Endert P, de Lonlay P
Cell Reports Medicine 2021;2(8):100370
Cell Reports Medicine 2021;2(8):100370
FYCO1 and autophagy control the integrity of the haploid male germ cell-specific RNP granules
Da Ros M, Lehtiniemi T, Olotu O, Fischer D, Zhang F, Vihinen H, Jokitalo E, Sironen A, Toppari J, Kotaja N
Autophagy 2017;13(2):302-321
Autophagy 2017;13(2):302-321
Repeated ER–endosome contacts promote endosome translocation and neurite outgrowth
Raiborg C, Wenzel E, Pedersen N, Olsvik H, Schink K, Schultz S, Vietri M, Nisi V, Bucci C, Brech A, Johansen T, Stenmark H
Nature 2015;520(7546):234-238
Nature 2015;520(7546):234-238
FYCO1 Contains a C-terminally Extended, LC3A/B-preferring LC3-interacting Region (LIR) Motif Required for Efficient Maturation of Autophagosomes during Basal Autophagy
Olsvik H, Lamark T, Takagi K, Larsen K, Evjen G, Øvervatn A, Mizushima T, Johansen T
Journal of Biological Chemistry 2015;290(49):29361-29374
Journal of Biological Chemistry 2015;290(49):29361-29374
No comments: Submit comment
No validations: Submit validation data