Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079443-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079443-B01P, RRID:AB_1573658
- Product name
- FYCO1 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human FYCO1 protein.
- Antigen sequence
MNTKVTSDWYYARSPFLQPKLSSDIVGQLYELTEV
QFDLASRGFDLDAAWPTFARRTLTTGSSAYLWKPP
SRSSSMSSLVSSYLQTQEMVSNFDLNSPLNNEALE
GFDEMRLELDQLEVREKQLQERMQQLDRENQELRA
AVSQQGEQLQTERERGRTAAEDNVRLTCLVAELQK
QWEVTQATQNTVKELQTCLQALELGAAEKEEDYHT
ALRRLESMLQPLAQELEATRDSLDKKNQHLASFPG
WLAMALHVGD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references FYCO1 Contains a C-terminally Extended, LC3A/B-preferring LC3-interacting Region (LIR) Motif Required for Efficient Maturation of Autophagosomes during Basal Autophagy.
Olsvik HL, Lamark T, Takagi K, Larsen KB, Evjen G, Øvervatn A, Mizushima T, Johansen T
The Journal of biological chemistry 2015 Dec 4;290(49):29361-74
The Journal of biological chemistry 2015 Dec 4;290(49):29361-74
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FYCO1 expression in transfected 293T cell line (H00079443-T01) by FYCO1 MaxPab polyclonal antibody.Lane 1: FYCO1 transfected lysate(28.05 KDa).Lane 2: Non-transfected lysate.
- Validation comment
- Western Blot (Transfected lysate)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FYCO1 MaxPab polyclonal antibody. Western Blot analysis of FYCO1 expression in human colon.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FYCO1 expression in transfected 293T cell line (H00079443-T01) by FYCO1 MaxPab polyclonal antibody.Lane 1: FYCO1 transfected lysate(28.05 KDa).Lane 2: Non-transfected lysate.