H00057215-B01P
antibody from Abnova Corporation
Targeting: THAP11
CTG-B43a, CTG-B45d, HRIHFB2206, RONIN
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057215-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057215-B01P, RRID:AB_1581319
- Product name
- THAP11 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human THAP11 protein.
- Antigen sequence
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRL
WLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRK
TYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQSSPSASTA
QTAQLQPNLVSASAAVLLTLQATVDSSQAPGSVQP
APITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASE
LQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHS
YSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKG
SIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Down-regulation of Thanatos-associated protein 11 by BCR-ABL promotes CML cell proliferation through c-Myc expression.
Nakamura S, Yokota D, Tan L, Nagata Y, Takemura T, Hirano I, Shigeno K, Shibata K, Fujisawa S, Ohnishi K
International journal of cancer 2012 Mar 1;130(5):1046-59
International journal of cancer 2012 Mar 1;130(5):1046-59
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of THAP11 expression in transfected 293T cell line by THAP11 MaxPab polyclonal antibody.Lane 1: THAP11 transfected lysate(34.54 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to THAP11 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol