HPA014300

QRFPR antibody from Sigma-Aldrich
GPR103
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014300
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014300, RRID:AB_1849251
Product name
Anti-QRFPR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014300
Antibody type
Polyclonal
Antigen
Pyroglutamylated RFamide peptide receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLV
YTPELPGRAKLA
Storage
-20C
Provider Type Product Number
- No reagents -