H00023644-B01

EDC4 antibody from Abnova Corporation
Ge-1, HEDLS, RCD-8

Antibody data

Product number
H00023644-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023644-B01, RRID:AB_1573864
Product name
EDC4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023644-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EDC4 protein.
Antigen sequence
MASCASIDIEDATQHLRDILKLDRPAGGPSAESPR
PSSAYNGDLNGLLVPDPLCSGDSTSANKTGLRTMP
PINLQEKQVICLSGDDSSTCIGILAKEVEIVASSD
SSISSKARGSNKVKIQPVAKYDWEQKYYYGNLIAV
SNSFLAYAIRAANNGSAMVRVISVSTSERTLLKGF
TGSVADLAFAHLNSPQLACLDEAGNLFVWRLALVN
GKIQEEILVHIRQPEGTPLNHFRRIIWCPFIPEES
EDCCEESSPTVALLHEDRAEVWDLDMLRSSHSTWP
VDVSQIKQGFIVVKGHSTCLSEGALSPDGTVLATA
SHDGYVKFWQIYIEGQDEPRCLHEWKPHDGRPLSC
LLFCDNHKKQDPDVPFWRFLITGADQNRELKMWCT
VSWTCLQTIRFSPDIFSSVSVPPSLKVCLDLSAEY
LILSDVQRKVLYVMELLQNQEEGHACFSSISEFLL
THPVLSFGIQVVSRCRLRHTEVLPAEEENDSLGAD
GTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQP
QLNPDVVAPLPTHTAHEDFTFGESRPELGSEGLGS
AAHGSQPDLRRIVELPAPADFLSLSSETKPKLMTP
DAFMTPSASLQQITASPSSSSSGSSSSSSSSSSSL
TAVSAMSSTSAVDPSLTRPPEELTLSPKLQLDGSL
TMSSSGSLQASPRGLLPGLLPAPADKLTPKGPGQV
PTATSALSLELQEVEPLGLPQASPSRTRSPDVISS
ASTALSQDIPEIASEALSRGFGSSAPEGLEPDSMA
SAASALHLLSPRPRPGPELGPQLGLDGGPGDGDRH
NTPSLLEAALTQEASTPDSQVWPTAPDITRETCST
LAESPRNGLQEKHKSLAFHRPPYHLLQQRDSQDAS
AEQSDHDDEVASLASASGGFGTKVPAPRLPAKDWK
TKGSPRTSPKLKRKSKKDDGDAAMGSRLTEHQVAE
PPEDWPALIWQQQRELAELRHSQEELLQRLCTQLE
GLQSTVTGHVERALETRHEQEQRRLERALAEGQQR
GGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKT
VPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENI
SKLLKSKNLTDAIARAAADTLQGPMQAAYREAFQS
VVLPAFEKSCQAMFQQINDSFRLGTQEYLQQLESH
MKSRKAREQEAREPVLAQLRGLVSTLQSATEQMAA
TVAGSVRAEVQHQLHVAVGSLQESILAQVQRIVKG
EVSVALKEQQAAVTSSIMQAMRSAAGTPVPSAHLD
CQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLY
VCETVDPAQVFGQPPCPLSQPVLLSLIQQLASDLG
TRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQV
RQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSL
P
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -