Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- EPAF-0571CQ - Provider product page
- Provider
- Creative Biolabs
- Product name
- Human Anti-C5AR1 Recombinant Antibody (clone Fab400)
- Antibody type
- Monoclonal
- Description
- This product is a human antibody that specifically recognizes C5AR1 from human. The antibody Fab400 is an epitope-specific antibody that can be used in ELISA and other immunological assays.
- Reactivity
- Human
- Host
- Human
- Conjugate
- Unconjugated
- Epitope
- MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN
- Antibody clone number
- Fab400
- Storage
- Centrifuge briefly prior to opening vial. Store at +4¡ãC short term (1-2 weeks). Aliquot and store at -20¡ãC long term. Avoid repeated freeze/thaw cycles.
No comments: Submit comment
No validations: Submit validation data