HPA029876

NKAIN4 antibody from MilliporeSigma / Merck KGaA
bA261N11.2, C20orf58, FAM77A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029876
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029876, RRID:AB_10602038
Product name
Anti-NKAIN4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029876
Antibody type
Polyclonal
Antigen
Na+/K+ transporting ATPase interacting 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKDSELLTFSLSRHRSWWRERWPGCLHEEVPAVGL
GAPHGQALVSGAGCALEPSYVEALHSCLQILIALL
GFVCGCQVVSVFTEEEDSFDFIGGFDPFPLYHVNE
KPSSLLSKQVY
Storage
-20C
Provider Type Product Number
- No reagents -