Antibody data

Product number
H00000741-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000741-M05, RRID:AB_1579866
Product name
ZNHIT2 monoclonal antibody (M05), clone 4G11
Provider product page
Abnova Corporation - H00000741-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNHIT2.
Antigen sequence
GEHPPGPLGTRGAMHEVARILLGEGPTNQKGYTLA
ALGDLAQTLGRARKQAVAREERDHLYRARKKCQFL
LAWTNENEAALTPLALDC
Isotype
IgG
Antibody clone number
4G11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -