Antibody data

Product number
H00007417-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007417-M01, RRID:AB_1137072
Product name
VDAC2 monoclonal antibody (M01), clone 3D2
Provider product page
Abnova Corporation - H00007417-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant VDAC2.
Antigen sequence
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGF
GLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLE
TKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQG
LKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDV
DFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKL
TRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVC
EDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASIS
AKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSIN
AGGHKVGLALELEA
Isotype
IgG
Antibody clone number
3D2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -