H00002197-M03

FAU antibody from Abnova Corporation
asr1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30, S30

Antibody data

Product number
H00002197-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002197-M03, RRID:AB_1574811
Product name
FAU monoclonal antibody (M03), clone 3C10
Provider product page
Abnova Corporation - H00002197-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FAU.
Antigen sequence
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIA
PEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGR
MLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGR
AKRRMQYNRRFVNVVPTFGKKKGPNANS
Isotype
IgG
Antibody clone number
3C10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -