H00002197-M03
antibody from Abnova Corporation
Targeting: FAU
asr1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30, S30
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002197-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002197-M03, RRID:AB_1574811
- Product name
- FAU monoclonal antibody (M03), clone 3C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant FAU.
- Antigen sequence
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIA
PEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGR
MLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGR
AKRRMQYNRRFVNVVPTFGKKKGPNANS- Isotype
- IgG
- Antibody clone number
- 3C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Global protein conjugation by ubiquitin-like-modifiers during ischemic stress is regulated by microRNAs and confers robust tolerance to ischemia.
Lee YJ, Johnson KR, Hallenbeck JM
PloS one 2012;7(10):e47787
PloS one 2012;7(10):e47787
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FAU expression in transfected 293T cell line by FAU monoclonal antibody (M03), clone 3C10.Lane 1: FAU transfected lysate(14.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to FAU on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol